LiveZilla Live Chat Software
Register/Login Login Contact UsContacts BlogBlog
Cart Items : 0 | Cart Total : R0
USA Categories
Site Security
Industrial & Scientific > Lab & Scientific Products > Life Science Supplies > Biomolecules > Antibodies > B00W6ANJWI
  1. GNRHR2 (Putative Gonadotropin-releasing Hormone II Receptor, GnRH II Receptor, GnRH-II-R, Type II GnRH Receptor), 127449-100ug
    Image(s) provided for illustrative purposes and may differ from the actual product
  2. GNRHR2 (Putative Gonadotropin-releasing Hormone II Receptor, GnRH II Receptor, GnRH-II-R, Type II GnRH Receptor), 127449-100ug

    Delivery: 10-20 Working Days
    Sold Out / Out of Stock

Product Description

  • Mab
  • 4A5
  • Recognizes human GNRHR2. Species Crossreactivity: mouse.
  • Supplied as a liquid in PBS, pH 7.2.
  • Purified by Protein A affinity chromatography.
Additional Information

Putative receptor for gonadotropin releasing hormone II (GnRH II) which is most probably non-functional. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: TLGCRRGHQELSIDSSKEGSGRMLQEEIHAFRQLEVQKTVTSRRAGETKGISITSI Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.


United States Biological
United States Biological
United States Biological
United States Biological
United States Biological
Please Note

The authorised South African distributor of this product is under no obligation to honour the manufacture's guarantees/warranties or to provide after-sales service.

Please note that this product is based in the USA, and is designed and labelled to be used in the USA. In addition, if the unit is powered it will come with a US plug and an adapter/transformer may be required. Please click here for more information on power requirements, or check with us if you are unsure or need any assistance!

Please also note that certain items cannot be imported, these include Alcohol, Agricultural Remedies, Animals, Batteries, Flammable Materials, Farm Feeds, Currency, Food, Furs, Chemicals, Explosives, Medications, Plants, Poinsons, Seeds, Supplements, Nutrients, Pressurized Cans, Tactical Equipment, Vitamins, Weaponry and Weaponry Accessories. In these cases, information displayed above is for reference/informational purposes only and the item will not be imported. All content is generated and displayed from an automated USA product feed, and if the item cannot be imported for any reason, including carrier restrictions and/or import or sales restrictions under South African or American law, we do reserve the right to cancel and refund the order in full. If you are not sure if we are permitted to bring in an item, please send us an e-mail with a link to the item to confirm.

Please also ensure that you are ordering the correct item for your particular application as returns to the USA are costly. Product reviews are also provided for most of our items, which can give you a good idea for possible things to look out for and the quality of the item. By clicking Add to Cart, you are confirming that the item is correct and you accept the conditions listed here.